DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and LOC100911361

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_038943607.1 Gene:LOC100911361 / 100911361 RGDID:6493616 Length:357 Species:Rattus norvegicus


Alignment Length:196 Identity:73/196 - (37%)
Similarity:118/196 - (60%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EGY-----EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKS 85
            ||:     |.|||:||||||.:||.::||..|.::|.:.|.||:|||.:..|||||||||...:.
  Rat     2 EGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEE 66

  Fly    86 VEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDEN 150
            |:....||||.:|.::||.|.|:.|:|..:.|             ..:..|:||:||:||..:|.
  Rat    67 VDAAMCARPHKVDGRVVEPKRAVSREDSVKPG-------------AHLTVKKIFVGGIKEDTEEY 118

  Fly   151 IVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKA 215
            .:|:||.::|.:.:::::.||::|::|.|.|:.|.|..:.:|.:..:.|.|.....|||::..|.
  Rat   119 NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQ 183

  Fly   216 D 216
            :
  Rat   184 E 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 38/76 (50%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/71 (32%)
LOC100911361XP_038943607.1 RRM1_hnRNPA3 11..91 CDD:410156 40/79 (51%)
RRM2_hnRNPA3 104..183 CDD:409996 26/78 (33%)
HnRNPA1 310..>326 CDD:402981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.