Sequence 1: | NP_476935.1 | Gene: | Rbp4 / 41668 | FlyBaseID: | FBgn0010258 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038943607.1 | Gene: | LOC100911361 / 100911361 | RGDID: | 6493616 | Length: | 357 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 73/196 - (37%) |
---|---|---|---|
Similarity: | 118/196 - (60%) | Gaps: | 18/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 EGY-----EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKS 85
Fly 86 VEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDEN 150
Fly 151 IVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKA 215
Fly 216 D 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp4 | NP_476935.1 | RRM_SF | 33..110 | CDD:302621 | 38/76 (50%) |
RRM2_hnRNPA_like | 137..209 | CDD:240774 | 23/71 (32%) | ||
LOC100911361 | XP_038943607.1 | RRM1_hnRNPA3 | 11..91 | CDD:410156 | 40/79 (51%) |
RRM2_hnRNPA3 | 104..183 | CDD:409996 | 26/78 (33%) | ||
HnRNPA1 | 310..>326 | CDD:402981 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |