DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and si:ch73-190f9.4

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_005161362.1 Gene:si:ch73-190f9.4 / 100332833 ZFINID:ZDB-GENE-131122-94 Length:287 Species:Danio rerio


Alignment Length:125 Identity:22/125 - (17%)
Similarity:47/125 - (37%) Gaps:34/125 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEA 130
            |||...||      :::.|:: :|....|...:.:::|           :.|.:||:.....|..
Zfish    72 DPVVPTSR------FIELKTL-LVSNLHPMVTEQQLIE-----------KFGALGSISTVQVCRN 118

  Fly   131 GFMNSKRIFLGGLKEYHDENIVR-------------EYFSQFGPVASVKLLMDRETGRQR 177
            ..::....|   :..:|..:.||             .....:||..::::|.|.::...|
Zfish   119 NIISPAYAF---VTFHHRRDAVRAQKALNFTDLLNKPLIIMWGPDKTIEVLSDNDSSSPR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 9/43 (21%)
RRM2_hnRNPA_like 137..209 CDD:240774 9/54 (17%)
si:ch73-190f9.4XP_005161362.1 RRM_SF 86..157 CDD:302621 11/85 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.