DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and zcrb1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001107973.1 Gene:zcrb1 / 100135752 XenbaseID:XB-GENE-999756 Length:215 Species:Xenopus tropicalis


Alignment Length:216 Identity:40/216 - (18%)
Similarity:78/216 - (36%) Gaps:51/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPH--- 95
            :::..|....|...|...||::|.|....:|:|..|..|:|..||.::|.:|.:...|...:   
 Frog    12 VYVSNLPFSLTNNDLHRIFSKYGKVVKVTILKDKDSRRSKGVAFVLFLDKESSQNCVRGLNNKQL 76

  Fly    96 ---------TIDN----KIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSK----------- 136
                     .|||    :.:..::...:......|..|.:  |:.|....:..:           
 Frog    77 FGRAIKASIAIDNGRATEFIRRRNYTDKSRCYECGDTGHL--SYACPKNMLGEREPPQKKEKKKR 139

  Fly   137 ------RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195
                  .:|.....|...|:...:..||  .:|..:..::.|..:.|.    :..:.|::|.:..
 Frog   140 KKIVEAEVFEEDESEDEGEDPALDSLSQ--AIAFQQARIEEEKNKYRH----DAAEASTSEDSRR 198

  Fly   196 PRKHWILQTLVEVKRSTQKAD 216
            ||          :|:||..:|
 Frog   199 PR----------IKKSTYFSD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/91 (22%)
RRM2_hnRNPA_like 137..209 CDD:240774 12/71 (17%)
zcrb1NP_001107973.1 RRM_ZCRB1 9..86 CDD:240839 17/73 (23%)
PTZ00368 <97..123 CDD:173561 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.