DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and celf5

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001090639.1 Gene:celf5 / 100036604 XenbaseID:XB-GENE-494002 Length:486 Species:Xenopus tropicalis


Alignment Length:288 Identity:65/288 - (22%)
Similarity:103/288 - (35%) Gaps:74/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQ------- 90
            |:|:|.:......:.|:..|.|||.:.:..||:|..:...:|..|:||....|....|       
 Frog    48 KLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQK 112

  Fly    91 ----RARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENI 151
                .|||       ::.|   |.....|||                 .:::|:|.|.:...|..
 Frog   113 TLPGMARP-------IQVK---PADSESRGG-----------------DRKLFVGMLSKQQSEEE 150

  Fly   152 VREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTL------VEVKR 210
            |...|..||.:....:|...: |..:...|::|...:.|:.|:.....  .||:      :.||.
 Frog   151 VTSMFQAFGSIEECSVLRGPD-GSSKGCAFVKFSSHAEAQAAIQALHG--SQTMPGASSSLVVKF 212

  Fly   211 STQKADRRFR--------FPIFSSVRAGYIPPQPATADSYNYN-----NPNYNPYLAQSVLPPSA 262
            :....:|..|        ..||:...|..|.|..|.|.:....     :.::..||:.||..||.
 Frog   213 ADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSPSVAFPSC 277

  Fly   263 F--------TNGWAHYVIPMAP-KPTPG 281
            .        .||     :|.|| .|..|
 Frog   278 HIQQIGAVNLNG-----LPAAPITPASG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 21/87 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 16/77 (21%)
celf5NP_001090639.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
RRM1_CELF3_4_5_6 42..128 CDD:241076 22/89 (25%)
PABP-1234 <49..374 CDD:130689 64/287 (22%)
RRM2_CELF3_4_5_6 134..214 CDD:241079 18/82 (22%)
RRM3_CELF3_4_5_6 397..475 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.