DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and RBM39

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_909122.1 Gene:RBM39 / 9584 HGNCID:15923 Length:530 Species:Homo sapiens


Alignment Length:181 Identity:40/181 - (22%)
Similarity:85/181 - (46%) Gaps:18/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAID------- 111
            |.|.:|...|:.....::|.:.|...|::..:.:.:|..:.||:|.|::.|.:..::.       
Human   151 DARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTG 215

  Fly   112 ----------KVSAADEHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVE 166
                      :.|.|:::...:...:.:|..|...:::||.|...|:::.::..|..||.|..::
Human   216 QRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQ 280

  Fly   167 MPFDKQKSQRKGFCFITF-DSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 216
            :..|.:..:.||:.|||| |||.....|.:....::||:.:.|...|.:.:
Human   281 LMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 13/87 (15%)
RRM2_hnRNPD_like 137..211 CDD:240775 22/74 (30%)
RBM39NP_909122.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 40/181 (22%)
Interaction with JUN. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..406 14/41 (34%)
Activating domain. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..355 14/41 (34%)
Interaction with ESR1 and ESR2. /evidence=ECO:0000250|UniProtKB:Q8VH51 355..406
Interaction with NCOA6. /evidence=ECO:0000250|UniProtKB:Q8VH51 406..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.