| Sequence 1: | NP_731825.1 | Gene: | sqd / 41666 | FlyBaseID: | FBgn0263396 | Length: | 344 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_011954.1 | Gene: | NAM8 / 856486 | SGDID: | S000001128 | Length: | 523 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 201 | Identity: | 41/201 - (20%) |
|---|---|---|---|
| Similarity: | 79/201 - (39%) | Gaps: | 70/201 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 SSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHF-GKYGEIESINVKTDPQTGRSRGFAFIVF 104
Fly 105 TNTE-------------------AIDKVSAADEHI------------INSKKVDPK---KAKA-- 133
Fly 134 ---------------------------------RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEV 165
Fly 166 EMPFDK 171 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sqd | NP_731825.1 | RRM1_hnRNPA_hnRNPD_like | 58..129 | CDD:409763 | 23/102 (23%) |
| RRM2_hnRNPD_like | 137..211 | CDD:240775 | 14/35 (40%) | ||
| NAM8 | NP_011954.1 | RRM1_NGR1_NAM8_like | 55..144 | CDD:410023 | |
| RRM2_SECp43_like | 162..241 | CDD:409781 | 18/78 (23%) | ||
| RRM3_NGR1_NAM8_like | 312..383 | CDD:409782 | 14/37 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||