DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and RIM4

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_011839.1 Gene:RIM4 / 856361 SGDID:S000001016 Length:713 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:44/142 - (30%)
Similarity:66/142 - (46%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NKQVDTEINGEDFTKDVTADGPGSENG-DAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWET 67
            |.:.|:..||     ||..:..|..:| |:....:::|..|::...|....|.|.:|||.|..||
Yeast   298 NNREDSRRNG-----DVIEEECGHVHGSDSEEKLTSDGIYDDEDKDSEITIDKRSIFVGQLDKET 357

  Fly    68 TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKK---VDPK 129
            |.:||...|..:|:|:.||:...|    :..||||.:...||......::.|.|...|   |..|
Yeast   358 TREELNRRFSTHGKIQDINLIFKP----TNIFAFIKYETEEAAAAALESENHAIFLNKTMHVQYK 418

  Fly   130 KAKARHGKIFVG 141
            :...||.:.|.|
Yeast   419 EVGGRHNRKFSG 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 25/73 (34%)
RRM2_hnRNPD_like 137..211 CDD:240775 2/5 (40%)
RIM4NP_011839.1 RRM 1..>191 CDD:223796
RRM1_RIM4_like 91..176 CDD:409887
RRM_SF 176..242 CDD:409669
SF-CC1 300..>378 CDD:273721 27/82 (33%)
RRM2_RIM4_like 343..420 CDD:409888 28/80 (35%)
YppG 615..>669 CDD:372950
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.