DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Y14

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_564591.1 Gene:Y14 / 841576 AraportID:AT1G51510 Length:202 Species:Arabidopsis thaliana


Alignment Length:191 Identity:43/191 - (22%)
Similarity:79/191 - (41%) Gaps:60/191 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENKQVDTEINGEDFTKDVTADGPGSENGD----AG------AAGSTNGSSDNQSAASG---QRDD 54
            |::.||.|...:|...:   :|...:..|    ||      |....||.|..::...|   ::|.
plant     5 ESEAVDFEPEEDDLMDE---EGTAIDGADVSPRAGHPRLKSAIAGANGESAKKTKGRGFREEKDS 66

  Fly    55 DRK---------------------------LFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQ 92
            ||:                           :.|.|:..||.|:::.:.||.:|||:::|:..|.:
plant    67 DRQRRLSSRDFESLGSDGRPGPQRSVEGWIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRR 131

  Fly    93 TGRSRGFAFIVFTNTE----AIDKVSAADEHIINSKKVD------P------KKAKARHGK 137
            :|..:|:|.|.:...|    ||..::.| |.:..:..||      |      ::..:|:|:
plant   132 SGYVKGYALIEYEKKEEAQSAISAMNGA-ELLTQNVSVDWAFSSGPSGGESYRRKNSRYGR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 24/86 (28%)
RRM2_hnRNPD_like 137..211 CDD:240775 0/1 (0%)
Y14NP_564591.1 RRM_RBM8 89..176 CDD:409762 23/87 (26%)

Return to query results.
Submit another query.