DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and RBP47A

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001321909.1 Gene:RBP47A / 841384 AraportID:AT1G49600 Length:450 Species:Arabidopsis thaliana


Alignment Length:238 Identity:55/238 - (23%)
Similarity:95/238 - (39%) Gaps:72/238 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NKQVDTEINGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETT 68
            |.:....:|...|:   |.:...||||                       .|..:|||.|:.:.:
plant   187 NAEQPFRLNWASFS---TGEKRASENG-----------------------PDLSIFVGDLAPDVS 225

  Fly    69 EKELRDHF-GKYGEIESINVKTDPQTGRSRGFAFIVF----TNTEAIDKVSAADEHIINSKKV-- 126
            :..|.:.| |:|..::...|..|..||||:|:.|:.|    ..:.|:.:::.|   ..:|:::  
plant   226 DAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGA---FCSSRQMRV 287

  Fly   127 ---DPKKAKA--------------RHG-------------KIFVGGLTTEISDEEIKTYFGQFGN 161
               .||:|.|              .||             .||||||..::::|::...|..||.
plant   288 GIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGE 352

  Fly   162 IVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGK 204
            :|.|::|..      ||..|:.|.:.|...:.:......:.||
plant   353 VVSVKIPVG------KGCGFVQFANRQSAEEAIGNLNGTVIGK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 20/80 (25%)
RRM2_hnRNPD_like 137..211 CDD:240775 20/68 (29%)
RBP47ANP_001321909.1 RRM1_SECp43_like 120..200 CDD:409780 2/12 (17%)
RRM2_SECp43_like 212..291 CDD:409781 21/81 (26%)
RRM_SF 326..397 CDD:473069 20/70 (29%)

Return to query results.
Submit another query.