DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and SR30

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_172386.3 Gene:SR30 / 837433 AraportID:AT1G09140 Length:268 Species:Arabidopsis thaliana


Alignment Length:178 Identity:42/178 - (23%)
Similarity:72/178 - (40%) Gaps:41/178 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTN-TEAIDKVSAADE 118
            :|.::||.|..:..:.|:.|.|.|||.|..|::|..|   |..|:||:.|.: .:|.|.:...|.
plant     6 NRTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPP---RPPGYAFVEFEDPRDADDAIYGRDG 67

  Fly   119 HIIN---------------SKKVD-------PKKAKARHG--KIFVGGLTTEISDEEIKTYFGQF 159
            :..:               |..||       ..:|.:|..  ::.|.||....|.:::|.:..:.
plant    68 YDFDGCRLRVEIAHGGRRFSPSVDRYSSSYSASRAPSRRSDYRVLVTGLPPSASWQDLKDHMRKA 132

  Fly   160 GNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVD 207
            |::.     |.:....|||.        ..|.|.......|.|.:::|
plant   133 GDVC-----FSEVFPDRKGM--------SGVVDYSNYDDMKYAIRKLD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 24/93 (26%)
RRM2_hnRNPD_like 137..211 CDD:240775 15/71 (21%)
SR30NP_172386.3 RRM_SF 8..79 CDD:473069 21/73 (29%)
RRM2_SF2_plant_like 109..184 CDD:410014 15/72 (21%)

Return to query results.
Submit another query.