DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and SC35

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:87 Identity:28/87 - (32%)
Similarity:46/87 - (52%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGQRD--DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFT-NTEAI 110
            ||..|  |...|.|..:::.||..:|...|.|||::..:.:..|.:||.||||||:.:. ..||.
plant     7 SGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAH 71

  Fly   111 DKVSAADEHIINSKKVDPKKAK 132
            ..|...|..:::.:::..:.||
plant    72 KAVERLDGRVVDGREITVQFAK 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 22/71 (31%)
RRM2_hnRNPD_like 137..211 CDD:240775
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 22/71 (31%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.