DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT5G54580

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_200269.1 Gene:AT5G54580 / 835546 AraportID:AT5G54580 Length:156 Species:Arabidopsis thaliana


Alignment Length:94 Identity:29/94 - (30%)
Similarity:49/94 - (52%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTN 106
            :::|:.|..|.:....|||.|||..||.:.||..|.::||:....|.||..:|.|:||.|:.:..
plant    42 AESQTPARPQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYAT 106

  Fly   107 TEAIDK-VSAADEHIINSKKVDPKKAKAR 134
            .|...| ::..|...::...:..:.|:.|
plant   107 LEDSAKGIAGMDGKFLDGWVIFAEYARPR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 24/71 (34%)
RRM2_hnRNPD_like 137..211 CDD:240775
AT5G54580NP_200269.1 RRM 55..138 CDD:440488 26/81 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.