DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT4G35785

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_974690.4 Gene:AT4G35785 / 829732 AraportID:AT4G35785 Length:239 Species:Arabidopsis thaliana


Alignment Length:155 Identity:33/155 - (21%)
Similarity:78/155 - (50%) Gaps:16/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TNGSSDNQSAASGQ-RDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAF 101
            :.|.|.::|....: .:....|:|.|||...|:|:|..||.|.|::.|..:..:|:|..||||||
plant    53 SRGRSRSRSRGRSEVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAF 117

  Fly   102 IVFTNTEAIDK-VSAADEHIINSKKVDPKKAKARHGKI-----FVGGLTTEISDEEIKTYFGQFG 160
            :..::.:..:: :...::.::..:.:..::::.:..:.     ::|..::..||.|.::..|:..
plant   118 VTMSSLKDAERCIKYLNQSVLEGRYITVERSRRKRPRTPTPGHYLGLKSSRDSDREGRSSRGRHY 182

  Fly   161 NIVEVE---------MPFDKQKSQR 176
            :..:..         .|.|:::|:|
plant   183 DRDDYRDRRSPRRDYSPRDERRSRR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 21/71 (30%)
RRM2_hnRNPD_like 137..211 CDD:240775 9/54 (17%)
AT4G35785NP_974690.4 RRM 71..154 CDD:440488 21/82 (26%)

Return to query results.
Submit another query.