DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT4G14300

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001328758.1 Gene:AT4G14300 / 827071 AraportID:AT4G14300 Length:411 Species:Arabidopsis thaliana


Alignment Length:408 Identity:135/408 - (33%)
Similarity:184/408 - (45%) Gaps:128/408 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118
            |..||||||:||||.|.:||:||..|||:....|..|..|||.|||.|::|::...:|:| ..::
plant     4 DQGKLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRV-LQEK 67

  Fly   119 HIINSKKVDPKKAKARH-------------------------GKIFVGGLTTEISDEEIKTYFGQ 158
            |.|::::||.|:|.:|.                         .|||||||...::|||.:.||..
plant    68 HSIDTREVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEV 132

  Fly   159 FGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGG- 222
            :|.:.:|.:.:|:..::.:||.|::||||..|..:|......::||:|:||||.||..|...|| 
plant   133 YGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKDANPGGGGR 197

  Fly   223 -MRGGPRGGMRG------------------------------GRGGYGGRGGYNNQWDGQGSYGG 256
             |.||..||.:|                              |..|||...|..:...|.|:|||
plant   198 SMGGGGSGGYQGYGGNESSYDGRMDSNRFLQHQSVGNGLPSYGSSGYGAGYGNGSNGAGYGAYGG 262

  Fly   257 YGGGYGGYGAG---------------------------------GYGD--YYAGGYYNGYDY--- 283
            |.|..||||||                                 |||:  |.:|..::||..   
plant   263 YTGSAGGYGAGATAGYGATNIPGAGYGSSTGVAPRNSWDTPASSGYGNPGYGSGAAHSGYGVPGA 327

  Fly   284 --------GYDGYGYG-GGFEG--NGYG--------GG---GGGNMGGGRGGPRGGGGPKG---- 322
                    ||...||| ||:.|  :|||        ||   |||:...|.||..|||...|    
plant   328 APPTQSPSGYSNQGYGYGGYSGSDSGYGNQAAYGVVGGRPSGGGSNNPGSGGYMGGGYGDGSWRS 392

  Fly   323 ------GGGFNGGKQRGG 334
                  |||:|.|:.|.|
plant   393 DPSQGYGGGYNDGQGRQG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 33/70 (47%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)
AT4G14300NP_001328758.1 RRM1_hnRNPA_hnRNPD_like 8..78 CDD:409763 33/70 (47%)
RRM2_Hrp1p 111..188 CDD:409767 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.