DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT3G13224

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_683559.2 Gene:AT3G13224 / 820515 AraportID:AT3G13224 Length:358 Species:Arabidopsis thaliana


Alignment Length:363 Identity:134/363 - (36%)
Similarity:177/363 - (48%) Gaps:71/363 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTN 106
            |.|.:..||......|:|:|||..:||......||||||||....:..|..||:.|||.||.|.:
plant     5 SRNDNFQSGDGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFAD 69

  Fly   107 TEAIDKVSAADEHIINSKKVD-----PKKAKARHG------KIFVGGLTTEISDEEIKTYFGQFG 160
            ...:||| ..|.|:||.|:|:     ||.|.....      ||||||:.:.::::|:|.:|.::|
plant    70 PSVVDKV-IEDTHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYG 133

  Fly   161 NIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLL-KTPKQKIAGKEVDVKRATPK---------- 214
            |:||.::..|.:.::.:||.|:.||||:||.:|| |.....:|..:|::|:|.||          
plant   134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSY 198

  Fly   215 ---PENQMMG---GMRGGPRGGMRGGRG-------GYGG-----RGGYNNQWDGQGSYG-GYGGG 260
               |..:...   ...|||.||..||.|       .:||     .|||..   |:||.| .:|||
plant   199 GSHPRGRSSNDSYASYGGPYGGFDGGYGHPPGPIRSHGGPASRYAGGYGY---GRGSVGPEFGGG 260

  Fly   261 YGGYGAGGYGDYYAGGYYNGYDYGYDG-YG-YGGGFEGNGYGGGG---------GGNMG-GGRGG 313
            |..||.|.     .|||.|....||.. :| ||.||.|.|||.||         ||..| ||.||
plant   261 YNNYGGGS-----LGGYRNEPPLGYSSRFGPYGSGFGGEGYGRGGEGAYLGYPRGGGEGYGGYGG 320

  Fly   314 PRGGGGPKGGGGFNGGKQRGGGG-------RQQRHQPY 344
            |..||..:.||  .||...|.||       ...|:.||
plant   321 PGYGGAYESGG--PGGSYEGAGGPYGRGYSSSSRYHPY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 32/75 (43%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/74 (39%)
AT3G13224NP_683559.2 RRM_SF 21..91 CDD:418427 32/70 (46%)
RRM_SF 110..188 CDD:418427 30/77 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.