DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT3G06970

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_187353.2 Gene:AT3G06970 / 819882 AraportID:AT3G06970 Length:317 Species:Arabidopsis thaliana


Alignment Length:70 Identity:27/70 - (38%)
Similarity:41/70 - (58%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121
            |:|||.|:|.||..:||.:|.::|::...||.::...|||:|:.||.|.     |.||.. ..:.
plant    13 KIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFR-----DYVSTV-RALQ 71

  Fly   122 NSKKV 126
            |||.:
plant    72 NSKPI 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 26/69 (38%)
RRM2_hnRNPD_like 137..211 CDD:240775
AT3G06970NP_187353.2 PABP-1234 <3..182 CDD:130689 27/70 (39%)
RRM_SF 12..87 CDD:473069 27/70 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.