DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and SLIRP

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_112487.1 Gene:SLIRP / 81892 HGNCID:20495 Length:109 Species:Homo sapiens


Alignment Length:107 Identity:19/107 - (17%)
Similarity:49/107 - (45%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ISNISFPNQQVEQKIHIADPVLIEASSKSWRQRRNELLGQMVAEERRNVEGLRESSQNGEKIDRA 196
            |:.:.:|...:.:..|:..|  .|::.:......||:...:....|.:|: .:::.....::.|:
Human   437 INLLYYPFSYLFRAAHVLMP--HESTVEHTHVDINEMESPLATRNRTSVD-FKDTDYKRHQLTRS 498

  Fly   197 LKRIVSLQSQLKQLKPESIISDSQKSLTNLNMDIDSDEEEND 238
                      :.::||.::...:.:.:|:.: |.|.||||.:
Human   499 ----------ISEIKPPNLFPLAPQEITHCH-DEDDDEEEEE 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763
RRM2_hnRNPD_like 137..211 CDD:240775 9/73 (12%)
SLIRPNP_112487.1 RRM_SLIRP 20..92 CDD:409688
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.