DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT2G22100

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_565526.1 Gene:AT2G22100 / 816745 AraportID:AT2G22100 Length:382 Species:Arabidopsis thaliana


Alignment Length:247 Identity:67/247 - (27%)
Similarity:95/247 - (38%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGQRD-DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112
            |..|| ..|.:||.||.|:||.:.|:..|..||||...:|..|..|||::||.|::|...:....
plant   155 SADRDSSQRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARA 219

  Fly   113 VSAADEHIINSKKVDPKKAKARHGKIFVGGLTTEISD--EEIKTYFGQFGNIVEVEMP------- 168
            .....|..:.::.|....|:.     |..|...|...  |.:|......||..|:.:|       
plant   220 ALKNPEKRMYNRTVSCLPARP-----FNSGKPREQQQPVESVKIDLSHTGNQSEMALPGIDLGHG 279

  Fly   169 FDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVD-VKRATPKPE-NQMMGGMRGGPR-GG 230
            .||...|::..                   ...||:.:. ...:.|.|. |.|.|.|.|.|. .|
plant   280 LDKGHQQQQNM-------------------SMYAGQNMPFYGHSQPPPGFNPMYGAMMGNPMVAG 325

  Fly   231 MRGGR---GGYGGRG--------GYNNQWDGQGSYGGYGGGYGGYGAGGYGD 271
            ::..|   .|...:|        |...|:.|.|:..|.|.| .|.|||..|:
plant   326 LQNYRMFGSGMMNQGPMMPPNHMGMVGQYVGDGNVNGVGAG-AGAGAGFDGE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 24/70 (34%)
RRM2_hnRNPD_like 137..211 CDD:240775 14/83 (17%)
AT2G22100NP_565526.1 PABP-1234 <164..>353 CDD:130689 52/212 (25%)
RRM_SF 165..235 CDD:418427 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.