DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and UBA1A

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_850021.1 Gene:UBA1A / 816744 AraportID:AT2G22090 Length:347 Species:Arabidopsis thaliana


Alignment Length:341 Identity:82/341 - (24%)
Similarity:117/341 - (34%) Gaps:88/341 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 STNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAF 101
            ||..||.:.|:.|...:.|.         |...:|||:....|.:.:.:::........|..::.
plant    37 STPYSSSSSSSDSSDSESDN---------EFDPEELRELLQPYSKDQLVDLVCSASRIGSSIYSA 92

  Fly   102 IVFTNTEAIDKVSAADEHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVE 166
            :          |.|||..:             .|.||||.||..|.:.|.:...|..:|.|.|..
plant    93 V----------VEAADRDV-------------THRKIFVYGLPWETTRETLVGVFEGYGEIEECT 134

  Fly   167 MPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGM 231
            :..||...:.|||.|:.|.:.:...:.||.||::|..:....:.|:..|.....|..:.||....
plant   135 VVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASGKGHDQPGPVKIS 199

  Fly   232 RGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGG------------YGAGGYGD------YYAGGYY 278
            .|....:    |...|...||.:...|||...            ||||..|:      ..|||  
plant   200 MGSMANH----GQPQQQQVQGQHVFNGGGMAASPFMLGNQYHPLYGAGMLGNPALAAAAAAGG-- 258

  Fly   279 NGYDY-------GYDGYG--------YGGGFEGNGYGGGGGGNMG--------------GGRGGP 314
             ||.|       .:.|.|        .||.......|..|...:|              ...||.
plant   259 -GYMYPMLAGALAHGGLGSDMVQSSQMGGIGVDPSVGAAGLSALGSYFRGQSLPSTYPDSDAGGK 322

  Fly   315 RGGG--GPKGGGGFNG 328
            ||.|  ...||..|:|
plant   323 RGTGKDSDAGGSSFHG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 10/70 (14%)
RRM2_hnRNPD_like 137..211 CDD:240775 24/73 (33%)
UBA1ANP_850021.1 RRM_SF 104..179 CDD:418427 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.