DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT2G21690

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_179762.1 Gene:AT2G21690 / 816707 AraportID:AT2G21690 Length:117 Species:Arabidopsis thaliana


Alignment Length:116 Identity:35/116 - (30%)
Similarity:55/116 - (47%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAI-DKVSAADEHIIN 122
            ||.||..:|.||:|.|.|.|:|.:....:..|..||:||.|.|:.|...::: |.:...|.....
plant    10 FVRGLDQDTDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAIMIMDVEESR 74

  Fly   123 SKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQK 173
            ||.|:            ||.:|.|::.:..|....:|. :..|.:..:|||
plant    75 SKCVN------------V
GSITVEVARQRRKNRSAEFA-LELVRLINEKQK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 25/70 (36%)
RRM2_hnRNPD_like 137..211 CDD:240775 10/37 (27%)
AT2G21690NP_179762.1 RRM 8..80 CDD:214636 25/81 (31%)

Return to query results.
Submit another query.