DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and hnrnpa3

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001315077.1 Gene:hnrnpa3 / 751729 ZFINID:ZDB-GENE-060224-1 Length:340 Species:Danio rerio


Alignment Length:338 Identity:129/338 - (38%)
Similarity:175/338 - (51%) Gaps:43/338 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEA 109
            :|..|.:.:..||||:||||:||||..||.||.::|::....|..||...|||||.|:.:::...
Zfish     2 ESRDSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSE 66

  Fly   110 IDKVSAADEHIINSKKVDPKKAKARHG-----------KIFVGGLTTEISDEEIKTYFGQFGNIV 163
            :|....|..|.::.:.|:||:|.:|..           ||||||:..:..:..|:.||..:|.|.
Zfish    67 VDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIE 131

  Fly   164 EVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGM--RGG 226
            .:::..::...:::||||:|||....|..::......|.....:|::|.||.|.|.....  |||
Zfish   132 TIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQSSSNQRYRGG 196

  Fly   227 PRGGMRG-----GRGGY-GGRG---GYNNQWDGQ--GSYGGYGGGYGGYGAG-GYGDYYAGGYYN 279
            ..|...|     ||||| ||||   |||. :.|.  |..||||||.||||.| |||:...||.:.
Zfish   197 GGGNFTGRGGNFGRGGYGGGRGGGDGYNG-FGGNYGGGPGGYGGGRGGYGGGPGYGNQGGGGGFG 260

  Fly   280 GYDYGYDGYGYGGGFEGNG--YGGGGGGNMG--GGRGGPR-----------GG--GGPKGGGGFN 327
            |:|...|...:||.|.|.|  .|||||||..  |..||.:           ||  .||.||||:.
Zfish   261 GFDNYNDRGNFGGNFGGGGGSSGGGGGGNYNDFGNYGGQQSNFGPMKGNNFGGRNSGPYGGGGYG 325

  Fly   328 GGKQRGGGGRQQR 340
            .|...||||...|
Zfish   326 SGGGGGGGGYGSR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 28/70 (40%)
RRM2_hnRNPD_like 137..211 CDD:240775 21/73 (29%)
hnrnpa3NP_001315077.1 RRM1_hnRNPA_like 14..91 CDD:241022 32/76 (42%)
RRM2_hnRNPA3 104..183 CDD:241026 23/78 (29%)
HnRNPA1 <296..>315 CDD:288479 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.