DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and LOC681410

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_003751688.1 Gene:LOC681410 / 681410 RGDID:1595414 Length:307 Species:Rattus norvegicus


Alignment Length:301 Identity:122/301 - (40%)
Similarity:160/301 - (53%) Gaps:31/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121
            |||:|||:.:|:|..||.||..:|.:....|..:|||.|||.|.|:.::|.|..|...||..|.:
  Rat     8 KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72

  Fly   122 NSKKVDPKKA-----KARHG------KIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQ 175
            :...|:.|:|     .||.|      |:|||||..::::.::..:|.|||.:.:.|:..|||..:
  Rat    73 DGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGAVEKAEIIADKQSGK 137

  Fly   176 RKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGG----MRGGPRGGMRGGRG 236
            ::||.|:.|.|..............|.|..|:||:|.||.:....||    .||| |||.||..|
  Rat   138 KRGFGFVYFQSHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIHAGGGGARAARGG-RGGGRGRGG 201

  Fly   237 GYGGRGGYNNQWDGQGSYGGYG--GGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYG-------- 291
            |.||.||.:.....:|..|||.  ||||||||  ||....||.|.|.|||....|:|        
  Rat   202 GGGGGGGRDQNGLAKGGGGGYNSYGGYGGYGA--YGGGGGGGSYGGSDYGNGFGGFGSYSQHQSS 264

  Fly   292 -GGFEGNGYGGGGGGNMGG-GRGGP-RGGGGPKGGGGFNGG 329
             |..:..|.||||||:.|| ...|| |||.|..||||:.||
  Rat   265 YGPMKSGGGGGGGGGSWGGRSNSGPYRGGYGGGGGGGYGGG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 28/70 (40%)
RRM2_hnRNPD_like 137..211 CDD:240775 24/73 (33%)
LOC681410XP_003751688.1 RRM1_hnRNPA0 5..83 CDD:240772 30/74 (41%)
RRM2_hnRNPA0 99..178 CDD:241023 27/78 (35%)
HnRNPA1 250..>269 CDD:288479 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.