DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Zcrb1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_080301.1 Gene:Zcrb1 / 67197 MGIID:1914447 Length:217 Species:Mus musculus


Alignment Length:170 Identity:41/170 - (24%)
Similarity:71/170 - (41%) Gaps:40/170 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAAD-EHII 121
            ::|..|.:..|..:|...|.|||::..:.:..|..|.:|:|.|||:|     :||.||.: ...|
Mouse    12 VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILF-----LDKDSALNCTRAI 71

  Fly   122 NSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCF----- 181
            |:|::..:..||                 .|....|:....:.....|||.|      |:     
Mouse    72 NNKQLFGRVIKA-----------------SIAIDNGRAAEFIRRRNYFDKSK------CYECGES 113

  Fly   182 --ITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQM 219
              :::...:.:....:.||:    ||...||..|:||.::
Mouse   114 GHLSYACPKNMLGEREPPKK----KEKKKKRKLPEPEEEI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 23/71 (32%)
RRM2_hnRNPD_like 137..211 CDD:240775 12/80 (15%)
Zcrb1NP_080301.1 RRM_ZCRB1 9..84 CDD:409827 25/93 (27%)
PTZ00368 <97..123 CDD:173561 5/31 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.