DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Rbm24

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001074894.1 Gene:Rbm24 / 666794 MGIID:3610364 Length:236 Species:Mus musculus


Alignment Length:71 Identity:28/71 - (39%)
Similarity:43/71 - (60%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121
            |:|||||.:.||:..||.:|..:|:||...|.||.|||:|||:.|:...:..|.::.......||
Mouse    12 KIFVGGLPYHTTDASLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPII 76

  Fly   122 NSKKVD 127
            :.:|.:
Mouse    77 DGRKAN 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 27/70 (39%)
RRM2_hnRNPD_like 137..211 CDD:240775
Rbm24NP_001074894.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 28/71 (39%)
Necessary for interaction with EIF4E. /evidence=ECO:0000250|UniProtKB:Q9BX46 175..199
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.