DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT5G08695

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001119193.1 Gene:AT5G08695 / 6241377 AraportID:AT5G08695 Length:690 Species:Arabidopsis thaliana


Alignment Length:147 Identity:43/147 - (29%)
Similarity:65/147 - (44%) Gaps:38/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VDTEINGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKE 71
            :|.|:..:...||  .||...|       ...:||.|...|.        :|||.||.:.|||:|
plant   195 IDGEVKADRVDKD--DDGHAME-------VEADGSDDVLDAG--------RLFVHGLPYSTTEEE 242

  Fly    72 LRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTE----AIDK------------VSAADEHI 120
            |.:||.|:|:|..:::..|..|...||.||:::...|    |:||            :..|....
plant   243 LMEHFSKFGDISEVHLVLDKDTRSCRGMAFVLYLIPESAKMAMDKLDKLPFQGRTLHILPAKPRA 307

  Fly   121 INSKKVD-----PKKAK 132
            :::|:||     ||..|
plant   308 MSAKQVDNSSNLPKSFK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 29/91 (32%)
RRM2_hnRNPD_like 137..211 CDD:240775
AT5G08695NP_001119193.1 RRM1_MRD1 4..79 CDD:241009
ELAV_HUD_SF 6..300 CDD:273741 36/121 (30%)
RRM3_RBM19_RRM2_MRD1 228..301 CDD:240762 25/72 (35%)
ELAV_HUD_SF 229..618 CDD:273741 32/96 (33%)
RRM4_RBM19_RRM3_MRD1 421..492 CDD:240763
RRM_SF 536..615 CDD:302621
RRM_SF 635..>661 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.