Sequence 1: | NP_731825.1 | Gene: | sqd / 41666 | FlyBaseID: | FBgn0263396 | Length: | 344 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571599.1 | Gene: | dazl / 58039 | ZFINID: | ZDB-GENE-000405-6 | Length: | 229 | Species: | Danio rerio |
Alignment Length: | 83 | Identity: | 25/83 - (30%) |
---|---|---|---|
Similarity: | 43/83 - (51%) | Gaps: | 6/83 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 LFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII- 121
Fly 122 --NSKKVDPKKAKARHGK 137 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sqd | NP_731825.1 | RRM_SF | 58..129 | CDD:302621 | 22/73 (30%) |
RRM2_hnRNPD_like | 137..211 | CDD:240775 | 0/1 (0%) | ||
dazl | NP_571599.1 | RRM | <40..>132 | CDD:223796 | 25/83 (30%) |
RRM_DAZL | 42..123 | CDD:241116 | 23/76 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |