DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and DAZ4

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001375413.1 Gene:DAZ4 / 57135 HGNCID:15966 Length:723 Species:Homo sapiens


Alignment Length:278 Identity:60/278 - (21%)
Similarity:102/278 - (36%) Gaps:103/278 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKL-----FVGGLSWETTEKELRDHFGKY 79
            ::|..|.:.|.......||..||  .:|:.|....:.|:     ||||:.....|.|:...||:|
Human     1 MSAANPETPNSTISREASTQSSS--AAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRY 63

  Fly    80 GEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSK-KVDP----KKAKARH---- 135
            |.::.:.:.|: :||.|:|:.|:.|.|...:.|:..:..|....| |:.|    :|..|||    
Human    64 GSVKEVKIITN-RTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPR 127

  Fly   136 ----------------------------------------------------------------- 135
                                                                             
Human   128 PLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAAS 192

  Fly   136 -------GKI-----FVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQ 188
                   |||     ||||:...:.:.||.:.||::|::.||:: ...:....||:.|::|.::.
Human   193 QGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKI-ITNRTGVSKGYGFVSFVNDV 256

  Fly   189 VVTDLLKTPKQKIAGKEV 206
            .|        |||.|.::
Human   257 DV--------QKIVGSQI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 23/80 (29%)
RRM2_hnRNPD_like 137..211 CDD:240775 22/75 (29%)
DAZ4NP_001375413.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 7/27 (26%)
RRM_DAZL 35..116 CDD:410073 24/81 (30%)
PABP-1234 42..412 CDD:130689 50/235 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..192 0/28 (0%)
RRM_DAZL 200..281 CDD:410073 23/76 (30%)
Daz 407..427 CDD:408642
Daz 431..451 CDD:408642
Daz 455..475 CDD:408642
Daz 479..499 CDD:408642
Daz 503..523 CDD:408642
Daz 527..547 CDD:408642
Daz 551..571 CDD:408642
Daz 575..595 CDD:408642
Daz 599..619 CDD:408642
Daz 623..643 CDD:408642
Daz 647..667 CDD:408642
Daz 671..691 CDD:408642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.