DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and dazap1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_021335308.1 Gene:dazap1 / 561459 ZFINID:ZDB-GENE-070212-1 Length:469 Species:Danio rerio


Alignment Length:347 Identity:102/347 - (29%)
Similarity:148/347 - (42%) Gaps:85/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRG 98
            |..||..:::..|..:|  |:..|||||||.|.||::.||::|.:|||:....:..|..|.:|||
Zfish     3 ALPSTTLATEMNSNLAG--DEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRG 65

  Fly    99 FAFIVFTNTEAIDKVSAADEHIINSKKVDPK----------KAKARHG------------KIFVG 141
            |.|:.|.:...:..|.....|.::.:.:|||          |.:.:.|            |||||
Zfish    66 FGFVKFKDPNCVRTVLDTKPHNLDGRNIDPKPCTPRGMQPEKTRTKDGWKGSKSDSNKSKKIFVG 130

  Fly   142 GLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEV 206
            |:.....:.|::.||.:||.:.||.|.:|.:|.:.:||.||||::||.|...:......|.||:|
Zfish   131 GIPHNCGEAELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKV 195

  Fly   207 DVKRATPK----PENQMMGGMRGGPRGGMRGGRGGYGGRGGYNNQWDG------QGSYGGYG--- 258
            :||:|.|:    |....:|..:.|||..:....|           |..      |.|||..|   
Zfish   196 EVKKAEPRDSKAPAPGQLGANQWGPRAIISAANG-----------WAAQPAPTWQQSYGPQGVWV 249

  Fly   259 ------GGYG-----GYGA------------------GGYG---DYYAGGYYNGYDYGYD-GYGY 290
                  .|||     |.||                  ||:|   .|...|:.....:||. |...
Zfish   250 STGQPLAGYGPPLPAGRGAPAQAPSPFNAFLVAAPPTGGFGAPQGYPQQGFSTQPQFGYSFGTPQ 314

  Fly   291 GGGFEGNGY----GGGGGGNMG 308
            |..|...|.    ...|.|.:|
Zfish   315 GDQFVAQGMPPPPATPGAGPLG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 26/70 (37%)
RRM2_hnRNPD_like 137..211 CDD:240775 31/73 (42%)
dazap1XP_021335308.1 RRM1_DAZAP1 24..105 CDD:241018 29/80 (36%)
RRM2_DAZAP1 127..202 CDD:240773 31/74 (42%)
FtsK <220..>430 CDD:332908 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.