DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and hnrnpa2b1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001192271.1 Gene:hnrnpa2b1 / 549680 XenbaseID:XB-GENE-490993 Length:350 Species:Xenopus tropicalis


Alignment Length:347 Identity:132/347 - (38%)
Similarity:179/347 - (51%) Gaps:56/347 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSA 115
            :::..||||:||||:||||..||:::.::|::....|..||.:.|||||.|:.|::.:.:|...|
 Frog     4 EKEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMA 68

  Fly   116 ADEHIINSKKVDPKKAKARH-----------GKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPF 169
            |..|.|:.:.|:||:|.||.           .|:||||:..:..:..::.||.::|.|..:|:..
 Frog    69 ARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIIT 133

  Fly   170 DKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMM-------------G 221
            |||..:::||.|:|||....|..::......|.|...:|::|..|.|.|.:             |
 Frog   134 DKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQNTRNSRGGNFGFG 198

  Fly   222 GMRG------GPRGGMRGGRGGY-GGRG---GYNNQWDGQ--GSYG---GYGGGYGGYGAG-GYG 270
            ..||      ||.|..||...|| ||||   |||....||  ||:|   |||||.||||.. |||
 Frog   199 DSRGGGNFGSGPGGNFRGSSDGYGGGRGYGDGYNGYGGGQSGGSFGGGPGYGGGRGGYGGSPGYG 263

  Fly   271 DYYAGGYYNGYDYGYDGYG---YGGGFEGNGYGG-----------GGGGNMGGGR--GGPRGGGG 319
            :...||...||..|||.||   ||||...|.:|.           ..|||.||.|  |||.|||.
 Frog   264 NQGGGGGGGGYGGGYDNYGGGNYGGGGSYNDFGNYNQQSSSYGPMKSGGNFGGNRSMGGPYGGGN 328

  Fly   320 PKGGGGFNGGKQRGGGGRQQRH 341
            ...|.|..||...||.|.:.|:
 Frog   329 YGPGSGSGGGSGGGGYGGRNRY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 29/70 (41%)
RRM2_hnRNPD_like 137..211 CDD:240775 23/73 (32%)
hnrnpa2b1NP_001192271.1 RRM1_hnRNPA2B1 7..87 CDD:241206 34/79 (43%)
RRM2_hnRNPA2B1 100..179 CDD:241025 24/78 (31%)
HnRNPA1 294..319 CDD:288479 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.