DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and RBM11

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001307531.1 Gene:RBM11 / 54033 HGNCID:9897 Length:288 Species:Homo sapiens


Alignment Length:60 Identity:17/60 - (28%)
Similarity:32/60 - (53%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAI 110
            |.:.||.:|||.|.....|:.|.:.|.:.|.:..:.:..| :.|:.:.|.|:.|.:.|::
Human     5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKD-REGKPKSFGFVCFKHPESV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 14/53 (26%)
RRM2_hnRNPD_like 137..211 CDD:240775
RBM11NP_001307531.1 RRM_RBM11 9..83 CDD:410006 16/56 (29%)
PABP-1234 <12..223 CDD:130689 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.