DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and msi1a

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_005171799.1 Gene:msi1a / 503755 ZFINID:ZDB-GENE-050306-36 Length:157 Species:Danio rerio


Alignment Length:135 Identity:55/135 - (40%)
Similarity:83/135 - (61%) Gaps:10/135 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TNGSSDNQSAASGQRDDDR-KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAF 101
            |.||..:.|:::.....|. |:|:|||||:||::.|:::|.|:||::...|..||.|.|||||.|
Zfish     3 TEGSQSSLSSSTQDSPHDPCKMFIGGLSWQTTQEGLKEYFCKFGEVKECMVMRDPVTKRSRGFGF 67

  Fly   102 IVFTNTEAIDKVSAADEHIINSKKVDPK---------KAKARHGKIFVGGLTTEISDEEIKTYFG 157
            :.:.:...:|||.|.:.|.::||.:|||         |...|..|||||||:...:.|::|.||.
Zfish    68 VTYVDQTGVDKVLAQNRHELDSKTIDPKVAFPRRAQPKLVTRTKKIFVGGLSVNTTIEDVKQYFD 132

  Fly   158 QFGNI 162
            |||.:
Zfish   133 QFGKV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 31/70 (44%)
RRM2_hnRNPD_like 137..211 CDD:240775 14/26 (54%)
msi1aXP_005171799.1 RRM <18..154 CDD:223796 51/120 (43%)
RRM1_MSI 24..98 CDD:241020 33/73 (45%)
RRM_SF 108..>144 CDD:302621 15/30 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.