DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and rbm34

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001004890.1 Gene:rbm34 / 448232 XenbaseID:XB-GENE-5895036 Length:412 Species:Xenopus tropicalis


Alignment Length:221 Identity:56/221 - (25%)
Similarity:94/221 - (42%) Gaps:61/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSDNQSAASGQRDDD---------------------RKLFVGGLSWETTEKELRDHFGKYGEIES 84
            |..|||.     |||                     |.:|||.|..:.|::.|:..|.::|.|||
 Frog   137 SKKNQSL-----DDDGVVVQPRKRKVNRAEERIKNKRTVFVGNLPADYTKQMLKSLFKEFGHIES 196

  Fly    85 -------------------INVKTDPQTGRSRGFAFIVFTN----TEAIDKVSA---ADEHIINS 123
                               |..|..|:  |....|:|||.:    ::|:.:..|   :..||   
 Frog   197 MRFRSVARAEANLSRKVAAIQRKVHPK--RKNINAYIVFKDESSASQALKRNGAEVGSGFHI--- 256

  Fly   124 KKVDPKKAKARHG---KIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFD 185
             :||....::.|.   ..|:|.|..||.:|.::.:|.:.|.:..|.:..|::....|||.::.|:
 Frog   257 -RVDIASKRSSHDNKRSAFIGNLPYEIEEEAVRDHFSECGKVQGVRIIRDQKTGIGKGFGYVLFE 320

  Fly   186 SEQVVTDLLKTPKQKIAGKEVDVKRA 211
            |...|...||....:::|:::.|||:
 Frog   321 SADAVQLALKLNNSELSGRKIRVKRS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 25/96 (26%)
RRM2_hnRNPD_like 137..211 CDD:240775 21/73 (29%)
rbm34NP_001004890.1 RRM1_RBM34 168..259 CDD:240840 24/96 (25%)
RRM2_RBM34 272..344 CDD:240841 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.