DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and nifk

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001005639.1 Gene:nifk / 448106 XenbaseID:XB-GENE-940532 Length:276 Species:Xenopus tropicalis


Alignment Length:92 Identity:22/92 - (23%)
Similarity:49/92 - (53%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAAD----- 117
            :::|.:.....|.:||::|.::|.:..:.:....:||.|:|:|::.| ..:.:.|: .||     
 Frog    43 IYIGHIPRALYEPQLREYFSQFGTVTRLRLSRSKKTGNSKGYAYVEF-ECDEVAKI-VADTMNNY 105

  Fly   118 ---EHIINSKKVDPKKAKARHGKIFVG 141
               |.::..:.|.|:|.   |.::|:|
 Frog   106 LFCERLLKCEFVPPEKV---HPRLFIG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 17/78 (22%)
RRM2_hnRNPD_like 137..211 CDD:240775 2/5 (40%)
nifkNP_001005639.1 RRM_NIFK_like 42..115 CDD:409748 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..211
hNIFK_binding 200..251 CDD:463489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..276
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.