DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Rb97D

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:230 Identity:77/230 - (33%)
Similarity:113/230 - (49%) Gaps:38/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSDNQSAASGQRDDD------RKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGF 99
            |:|....|..:.||.      ||||:|||:..|||:.|:..:|::|::..:.|..|..|.|||||
  Fly    11 SADVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGF 75

  Fly   100 AFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH-----------GKIFVGGLTTEISDEEIK 153
            .||.:|.:..:|:......|||:.|.|:.|:|..|.           .|:|||||.....:|.::
  Fly    76 GFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLR 140

  Fly   154 TYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA---TPKP 215
            .||.||||:|.|::..||...:|:||.|:.||....|...:...:..|....||||::   ..|.
  Fly   141 EYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKK 205

  Fly   216 ENQMMGGM--------------RGG----PRGGMR 232
            |.|..||:              :||    |.|.|:
  Fly   206 EKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 28/70 (40%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 31/76 (41%)
RRM2_hnRNPA_like 124..196 CDD:240774 27/71 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463965
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.