DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and msi

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster


Alignment Length:240 Identity:86/240 - (35%)
Similarity:124/240 - (51%) Gaps:28/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GPGSENGDAGAAGSTNGSSDNQ-----SAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIE 83
            |.|..||.|...||....|..:     |..||......|||||||||:|:..:|:::|..:|.:.
  Fly   166 GAGQNNGQAAMGGSNKSGSSGRSTPSLSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVT 230

  Fly    84 SINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--------GKIFV 140
            .:.:..||.|.|||||.||.|.....::||.....|.::.||:|||.|..::        .||||
  Fly   231 DVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKKIFV 295

  Fly   141 GGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKE 205
            ||::.:.|.||:|.||.|||.:.|..|..|:|..:.:||.|:||::|.||..:.:.....|..|:
  Fly   296 GGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKK 360

  Fly   206 VDVKRATPKP---------ENQMMGGMRG-----GPRGGMRGGRG 236
            |:.|:|.||.         :.::|.|..|     .| |.:.|.||
  Fly   361 VECKKAQPKEAVTPAAQLLQKRIMLGTLGVQLPTAP-GQLIGARG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 29/70 (41%)
RRM2_hnRNPD_like 137..211 CDD:240775 31/73 (42%)
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 29/70 (41%)
RRM2_MSI 292..365 CDD:240769 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496221at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.