DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and CG6937

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_651066.2 Gene:CG6937 / 42662 FlyBaseID:FBgn0038989 Length:356 Species:Drosophila melanogaster


Alignment Length:138 Identity:31/138 - (22%)
Similarity:57/138 - (41%) Gaps:30/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 EAIDKVSA------ADEHIINSK------KVDPKKAKA-RHGKIFVGGLTTEISDEEIKTYFGQF 159
            :.|:|.|.      |.:::::.:      |..|:|.|. ..|.:.|..|.....:::::.||.||
  Fly    10 QKIEKQSTPKKPIDAAKNVVSGQLKKKVTKARPQKPKGPERGVVIVKHLPHGFFEQQLRQYFRQF 74

  Fly   160 GNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVD--------VKRATPKPE 216
            |.::.|.:....:....||:.|:.|:..:|.         |:|...:|        ||.....||
  Fly    75 GRVLRVRLARSLRTGNSKGYAFVEFEYPEVA---------KVAADTMDNYLMFQKVVKATYIPPE 130

  Fly   217 NQMMGGMR 224
            .|.:...|
  Fly   131 KQTLNFFR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 5/32 (16%)
RRM2_hnRNPD_like 137..211 CDD:240775 18/81 (22%)
CG6937NP_651066.2 RRM_NIFK_like 52..125 CDD:409748 18/81 (22%)
RRN3 <242..>306 CDD:461623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.