DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and SLIRP2

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:84 Identity:29/84 - (34%)
Similarity:46/84 - (54%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112
            :||......|||||.|.|....||||.:|.|||.:.:..|..|.|.|.|:.:.|:||:..:|.:.
  Fly     2 SSGFVRSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNS 66

  Fly   113 VSAADEHIINSKKVDPKKA 131
            .|..:.|.::.:.:..::|
  Fly    67 ASNQNTHFLDGRVLTVQRA 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 25/70 (36%)
RRM2_hnRNPD_like 137..211 CDD:240775
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 26/71 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.