DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and hnrnpa1a

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_021335234.1 Gene:hnrnpa1a / 393467 ZFINID:ZDB-GENE-040426-1546 Length:445 Species:Danio rerio


Alignment Length:405 Identity:135/405 - (33%)
Similarity:174/405 - (42%) Gaps:131/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RKLFVGGLSWETTEKELRDHFGKYGEIESI----------------------------NVKTDPQ 92
            ||||:||||:|||::.||.||.::|.:...                            .|..||.
Zfish    38 RKLFIGGLSFETTDESLRAHFEQWGTLTDCVVSPSAAIHMLMYEREEHLKVAGFLYCSQVMRDPN 102

  Fly    93 TGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARHG-----------KIFVGGLTTE 146
            |.|||||.|:.:::...:|....|..|.::.:.|:||:|.:|..           |:||||:..:
Zfish   103 TKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDSSKPGAHSTVKKMFVGGIKED 167

  Fly   147 ISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211
            ..:|.::.||||||.|.||.:..:|...:|:||.|||||....|..::......:.|...:|::|
Zfish   168 TDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFITFDDHDAVDRIVIQKYHTVNGHNCEVRKA 232

  Fly   212 TPKPE-NQMMGGMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGA-GGYGDYYA 274
            ..:.| |::....||| |||..|..||..||||      |.|..|||||||||.|. ||.|.|..
Zfish   233 LSREEMNRVSMNSRGG-RGGGGGSGGGNFGRGG------GGGGGGGYGGGYGGGGGRGGGGGYGG 290

  Fly   275 GGYYNGY------------------------------------DYGYDGYGYGGG----FEGNGY 299
            |..||||                                    .||..|.|||||    :..||.
Zfish   291 GDGYNGYGGGNGISTDKSGYGGGGPNYGGNRGYGSGGGGGGGGGYGNQGGGYGGGGYDNYNNNGG 355

  Fly   300 GGGGGGNMGGGR----------------------------------------GGPRG---GGGPK 321
            |||||||.|||.                                        |||.|   |||..
Zfish   356 GGGGGGNFGGGNFGGGGDYNDFGNYNNQSSSNYGPMKGGNYGGGGGGGGRSGGGPYGGGYGGGSG 420

  Fly   322 GGGGFNGGKQRGGGG 336
            ||||:.||...||||
Zfish   421 GGGGYGGGSGGGGGG 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 28/98 (29%)
RRM2_hnRNPD_like 137..211 CDD:240775 27/73 (37%)
hnrnpa1aXP_021335234.1 RRM_SF 36..144 CDD:327398 33/105 (31%)
RRM_SF 157..233 CDD:327398 27/75 (36%)
HnRNPA1 376..>392 CDD:314495 0/15 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.