DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and bol

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster


Alignment Length:65 Identity:21/65 - (32%)
Similarity:38/65 - (58%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121
            ::||||:|.:|||.:|...|..||.::|..:..| :.|.|:|:.|:.|...:...::.|..|.::
  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQADGECVV 97

  Fly   122  121
              Fly    98  97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 21/64 (33%)
RRM2_hnRNPD_like 137..211 CDD:240775
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 21/65 (32%)
PABP-1234 <45..219 CDD:130689 15/54 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.