DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and CG3594

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster


Alignment Length:254 Identity:59/254 - (23%)
Similarity:98/254 - (38%) Gaps:90/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENKQVDTE--INGEDFTKDVTADGPGSENGDAGAAGS-TNGSSDNQSAASGQRDDDR-------- 56
            |...||.|  .|..| .:|..::.....:.:|.|.|| .:|:.:.:||.:||...|:        
  Fly    45 EGTYVDKEDGRNPSD-PEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGA 108

  Fly    57 ------KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFI------VFTN--- 106
                  .|:|..|::|||:.:|..||...|.::||.:   |:..|. ||||:      .|.|   
  Fly   109 SKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRI---PKKRRG-GFAFVEMADLSSFQNAFQ 169

  Fly   107 ---------------TEAIDKVSAADEHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYF 156
                           :||..|.||..::||..|  :.|.|:.|             ::::..|..
  Fly   170 LHNTELQGRNIKVQISEAGKKKSANKKNIIKQK--NRKLAEMR-------------NEQKTFTKS 219

  Fly   157 GQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKP 215
            |:|         :||                    ||.|...:::..::...|:..|:|
  Fly   220 GKF---------YDK--------------------DLKKEKAKEMLARKRWRKKPAPRP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 28/94 (30%)
RRM2_hnRNPD_like 137..211 CDD:240775 9/73 (12%)
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 42/156 (27%)
RRM 116..187 CDD:440488 20/74 (27%)

Return to query results.
Submit another query.