DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and CG4612

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:233 Identity:64/233 - (27%)
Similarity:107/233 - (45%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHF 76
            :|...|...:|:......|.|.|:|||.||..|.|..||      |:::..|......|.:.|.|
  Fly    75 SGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSG------KIYIKNLERSIDNKAVYDTF 133

  Fly    77 GKYGEIESINVKTDPQTGRSRGFAFIVFTNTE----AIDKVSAADEHIINSKKV---------DP 128
            ..:|.|.:.||..| :.|.|||:.|:.|.:.|    ||:||:..   :.|::||         |.
  Fly   134 SVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAIEKVNGM---LCNNQKVHVVKFIPRRDR 194

  Fly   129 KKAKARHGK-IFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTD 192
            ::.||.|.| ::|..|:.|.:::.::..|..:|.|...::..|::...|: |.|:.:::      
  Fly   195 EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVAYEN------ 252

  Fly   193 LLKTPKQKIA------GKEVD------VKRATPKPENQ 218
                |:..:|      ||::.      |.||..|.|.|
  Fly   253 ----PQSALAAVIGLHGKQLGDNKFLYVARALSKAERQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 24/83 (29%)
RRM2_hnRNPD_like 137..211 CDD:240775 16/86 (19%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/73 (32%)
RRM3_I_PABPs 202..282 CDD:240826 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.