DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sqd and SLIRP1

DIOPT Version :9

Sequence 1:	NP_731825.1	Gene:	sqd / 41666	FlyBaseID:	FBgn0263396	Length:	344	Species:	Drosophila melanogaster
Sequence 2:	NP_001027083.1	Gene:	SLIRP1 / 3772560	FlyBaseID:	FBgn0064117	Length:	90	Species:	Drosophila melanogaster

Alignment Length:	75	Identity:	25/75 - (33%)
Similarity:	46/75 - (61%)	Gaps:	0/75 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121
            ::|||.|.|....:|||.:|.::|.:.|.||..|.:||.|:|:.|:.|.:..|::|:....:||:
  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80

  Fly   122 NSKKVDPKKA 131
            ....::.:|:
  Fly    81 EGNYLNIQKS 90

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sqd	NP_731825.1	RRM_SF	58..129	CDD:302621	24/70 (34%)
sqd	NP_731825.1	RRM2_hnRNPD_like	137..211	CDD:240775
SLIRP1	NP_001027083.1	RRM_SLIRP	16..88	CDD:409688	24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45464002
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840