DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and SLIRP1

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:75 Identity:25/75 - (33%)
Similarity:46/75 - (61%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121
            ::|||.|.|....:|||.:|.::|.:.|.||..|.:||.|:|:.|:.|.:..|::|:....:||:
  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80

  Fly   122 NSKKVDPKKA 131
            ....::.:|:
  Fly    81 EGNYLNIQKS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 24/70 (34%)
RRM2_hnRNPD_like 137..211 CDD:240775
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.