DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Rbm38

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_063140362.1 Gene:Rbm38 / 366262 RGDID:1308503 Length:266 Species:Rattus norvegicus


Alignment Length:72 Identity:29/72 - (40%)
Similarity:42/72 - (58%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SAASGQRDDD--RKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTE 108
            ||..|.:.|.  .|:|||||.:.||:..||.:|..:|:||...|.||.|||:|||:.|.:....|
  Rat    20 SAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFGIVAALE 84

  Fly   109 AIDKVSA 115
            ....:::
  Rat    85 GTQNLNS 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 24/58 (41%)
RRM2_hnRNPD_like 137..211 CDD:240775
Rbm38XP_063140362.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.