DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Dazap1

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_006241030.1 Gene:Dazap1 / 362836 RGDID:1305280 Length:406 Species:Rattus norvegicus


Alignment Length:414 Identity:120/414 - (28%)
Similarity:161/414 - (38%) Gaps:130/414 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKV 113
            |...|:..|||||||.|.||::.||.:|.:|||:....:..|..|.:||||.|:.|.:...:..|
  Rat     3 SAGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTV 67

  Fly   114 SAADEHIINSKKVDPK----------KAKARHG-------------KIFVGGLTTEISDEEIKTY 155
            .|:..|.::.:.:|||          :.:.:.|             ||||||:.....:.|::.|
  Rat    68 LASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDSSKSNKIFVGGIPHNCGETELREY 132

  Fly   156 FGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMM 220
            |.:||.:.||.|.:|.:|.:.:||.||||:.||.|...:......|.||:|:||||.|:......
  Rat   133 FKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKNQA 197

  Fly   221 GGMRGGPRGGMR-------GGRG--------GYGGRGGYNNQWDGQG-SYGGYG----------- 258
            .|..|..:.|.|       |..|        |||.:|    .|...| :.||||           
  Rat   198 PGQPGASQWGSRVAPSAANGWAGQPPPTWQQGYGPQG----MWVPAGQAIGGYGPPPAGRGAPPP 258

  Fly   259 -------------GGY-------GGYGAG-----GYG------DYYA-----------GGYYNGY 281
                         ||:       .||||.     |||      |.:|           |.....:
  Rat   259 PPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAF 323

  Fly   282 -------------------DYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPR--GGGGPKGGGG 325
                               |:.|..||||....|.|.|...........|||.  |.|||..|| 
  Rat   324 PPPPSQAAPDMSKPPTAQPDFPYGQYGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGG- 387

  Fly   326 FNGGKQRGGGGRQQRH-----QPY 344
                   .|.||.|.|     .||
  Rat   388 -------SGFGRGQNHNVQGFHPY 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 27/70 (39%)
RRM2_hnRNPD_like 137..211 CDD:240775 31/73 (42%)
Dazap1XP_006241030.1 RRM1_DAZAP1 11..92 CDD:409988 30/80 (38%)
RRM2_DAZAP1 111..190 CDD:409765 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.