DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Msi2

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_038943587.1 Gene:Msi2 / 360596 RGDID:1560397 Length:354 Species:Rattus norvegicus


Alignment Length:356 Identity:118/356 - (33%)
Similarity:157/356 - (44%) Gaps:75/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQT 93
            ||..|.:||.|.|          :.|..|:|:|||||:|:...|||:|.|:|||....|..||.|
  Rat     4 NGSPGTSGSANDS----------QHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTT 58

  Fly    94 GRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPK---------KAKARHGKIFVGGLTTEISD 149
            .|||||.|:.|.:..::|||.....|.::||.:|||         |...|..|||||||:.....
  Rat    59 KRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVV 123

  Fly   150 EEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214
            |::|.||.|||.:.:..:.|||..::.:||.|:||::|.||..:.:....:|..|.|:.|:|.||
  Rat   124 EDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPK 188

  Fly   215 PENQMMGGMRGGPRG----------GMRGGRGGYGGRGGYNN--QWDGQGSYGGYGGGYG----- 262
             |.....|.||..||          ||        |..||.|  ...|:| |.|:...||     
  Rat   189 -EVMFPPGTRGRARGLPYTMDAFMLGM--------GMLGYPNFVATYGRG-YPGFAPSYGYQFPA 243

  Fly   263 -------GYGAGGYGDYYA-------GGYYNGY----DYGYDGYGYG------GGFEGNGYGGG- 302
                   .:.|..||...|       |...|.|    ::|......|      |||.|....|. 
  Rat   244 LLPYLNASFPAAAYGPVAAAAVAAARGSVLNSYSAQPNFGAPTSPAGSNPARPGGFPGANSPGPV 308

  Fly   303 ----GGGNMGGGRGGPRGGGGPKGGGGFNGG 329
                |..:...|.|.......|:.|.||..|
  Rat   309 ADLYGPASQDSGVGNYISAASPQPGSGFGHG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 33/70 (47%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)
Msi2XP_038943587.1 RRM1_MSI2 17..109 CDD:410153 38/91 (42%)
PABP-1234 <35..351 CDD:130689 102/315 (32%)
RRM2_MSI 111..184 CDD:240769 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.