DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Caper

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster


Alignment Length:188 Identity:41/188 - (21%)
Similarity:81/188 - (43%) Gaps:25/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEA---- 109
            |.:..|.|.:|...||.....::|.:.|...|::..:.:.|..:|.|.:|.|:|.|.:.|:    
  Fly   230 SPEERDARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALA 294

  Fly   110 --------------IDKVSAADEHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFG 160
                          :....|....:.|:......|:.....:::||.|...|:::.::..|..||
  Fly   295 LGLSGQRLLGVPIMVQHTQAEKNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIFEPFG 359

  Fly   161 NIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQ----KIAGKEVDVKRATPK 214
            .|..:::..|.:..:.||:.|||:.:   ..|..|..:|    ::||:.:.|...|.:
  Fly   360 KIDAIQLIMDTETGRSKGYGFITYHN---ADDAKKALEQLNGFELAGRLMKVGNVTER 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 16/88 (18%)
RRM2_hnRNPD_like 137..211 CDD:240775 20/77 (26%)
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 14/71 (20%)
RRM2_RBM23_RBM39 337..409 CDD:240730 19/74 (26%)
RBM39linker 425..500 CDD:292157
RRM3_RBM39_like 483..567 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.