DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Secp43

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster


Alignment Length:260 Identity:59/260 - (22%)
Similarity:100/260 - (38%) Gaps:64/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGE-IESINVKTDPQTGRSRGFAFIVF-TNTEAIDKVSAADEH 119
            :|::|.|....||..:...|.|.|| ..::.:..:..||...|:.|:.| ::..|:|.:     |
  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAM-----H 66

  Fly   120 IINSKKVDPKK-----------------AKARHGKIFVGGLTTEISDEEI-KTYFGQFGNIVEVE 166
            .:|.|.:....                 ...|...::||.|::::.|.:: |.:..:|.:|...:
  Fly    67 KLNGKPIPGTNPIVRFRLNSASNSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAK 131

  Fly   167 MPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAG------KEVDVKRATPKPENQMMGGMRG 225
            :..| .....||:.|:.|..|    |..|:....:.|      |.:.:..|.|||::::      
  Fly   132 VILD-SLGFSKGYGFVRFGIE----DEQKSALYDMNGYIGLGTKPIKICNAVPKPKSEL------ 185

  Fly   226 GPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYY--AGGYYNGYDYGYDGY 288
                      ||..|.|..|.         |||.|....|...|..||  ...|:.||. .:.||
  Fly   186 ----------GGAVGEGNTNY---------GYGSGMTAAGGTDYSQYYDPTSTYWQGYQ-AWQGY 230

  Fly   289  288
              Fly   231  230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 19/72 (26%)
RRM2_hnRNPD_like 137..211 CDD:240775 17/80 (21%)
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 19/87 (22%)
RRM2_SECp43 99..180 CDD:241056 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.