DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and hnrnpa0a

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_997810.2 Gene:hnrnpa0a / 323529 ZFINID:ZDB-GENE-030131-2249 Length:305 Species:Danio rerio


Alignment Length:304 Identity:122/304 - (40%)
Similarity:164/304 - (53%) Gaps:36/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121
            |||||||:.:||:..||:||.:||::....|..:.|..|||.|.|:.:::.:..|...:|..||:
Zfish    11 KLFVGGLNVQTTDDGLRNHFEQYGKLTDCVVVQNQQLKRSRCFGFVTYSSPDEADSAMSARPHIL 75

  Fly   122 NSKKVDPKKAKARHG-----------KIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQ 175
            :...|:.|:|.||..           |||:|||..:|.::.::..|.|||.:.:.|:..||:..:
Zfish    76 DGNNVELKRAVAREDAGKPEALAKVKKIFIGGLKDDIEEDHLRDCFSQFGAVEKAEVITDKETGK 140

  Fly   176 RKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRG---- 236
            ::||.|:.|:........:......|.|.:|:||:|..|.|.| ..|.|||.|||..||||    
Zfish   141 KRGFGFVYFEDNDSADKAVVLKFHIINGHKVEVKKALTKQEMQ-AAGSRGGGRGGRGGGRGMGRP 204

  Fly   237 --GYGGRGGYNNQWDGQGSYGGYGGGYG---GYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFE- 295
              |||||||      |.|:||  |||||   ||| ||||..|.|||..||....:|||.|.|:. 
Zfish   205 QNGYGGRGG------GYGNYG--GGGYGGNDGYG-GGYGGGYGGGYGGGYGDQMEGYGGGNGYND 260

  Fly   296 -GNGYG--GGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 336
             |:|||  ..|.|.|.|...|.......:||||  ||..|||.|
Zfish   261 FGSGYGQQSSGYGPMKGNYSGRSNAPYSRGGGG--GGYGRGGYG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 26/70 (37%)
RRM2_hnRNPD_like 137..211 CDD:240775 23/73 (32%)
hnrnpa0aNP_997810.2 RRM1_hnRNPA0 8..86 CDD:240772 28/74 (38%)
RRM_SF 102..181 CDD:302621 25/78 (32%)
HnRNPA1 260..286 CDD:288479 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.