DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and Rbp1-like

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:208 Identity:51/208 - (24%)
Similarity:68/208 - (32%) Gaps:98/208 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 KIFVGGLTTEISDEEIKTYFGQFG---NIVEVEMPFDKQKSQRKGFCFITF----DSEQVVTDLL 194
            |::||.|.:..|..||:..|.::|   |:.....|        .||.|:.|    |:|.....|.
  Fly    12 KVYVGNLGSSASKYEIENAFSKYGPLRNVWVARNP--------PGFAFVEFEDRRDAEDATRGLD 68

  Fly   195 KTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGG 259
            .|   :..|..:.|:.::                |..|.||||                      
  Fly    69 GT---RCCGTRIRVEMSS----------------GRSREGRGG---------------------- 92

  Fly   260 GYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGG 324
                                                |.|.||||||:.|||||   ||.|.:.||
  Fly    93 ------------------------------------GGGGGGGGGGSGGGGRG---GGSGARAGG 118

  Fly   325 GFNGGKQRGGGGR 337
               ||:...||||
  Fly   119 ---GGRAGDGGGR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763
RRM2_hnRNPD_like 137..211 CDD:240775 21/80 (26%)
Rbp1-likeNP_001188585.1 RRM_SRSF3_like 12..81 CDD:409808 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.