DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and gar2

DIOPT Version :9

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_593531.1 Gene:gar2 / 2542869 PomBaseID:SPAC140.02 Length:500 Species:Schizosaccharomyces pombe


Alignment Length:364 Identity:95/364 - (26%)
Similarity:144/364 - (39%) Gaps:106/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAENKQVDTEINGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRK-------- 57
            :.|..:...|.:.|..:...::....||:||      ::.|||::|.:|.:.:..||        
pombe   190 VVEKTEEKKEGSSESSSDSESSSDSSSESGD------SDSSSDSESESSSEDEKKRKAEPASEER 248

  Fly    58 ----------------LFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTN 106
                            :|||.|||...::.|...|.:||.|....|..|.|:|||:|:.::.|..
pombe   249 PAKITKPSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFET 313

  Fly   107 TEAIDKVSAA------DEHIINSKKVDPKK------AKARHGK-----------IFVGGLTTEIS 148
            .||.....||      |..::|....:|:.      |:.|.|.           :|||.|:...:
pombe   314 PEAAKAAVAANGTKEIDGRMVNLDLSNPRPANPQPYAQQRAGNFGDQLSEPSDTVFVGNLSFNAT 378

  Fly   149 DEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATP 213
            ::::.|.||..|:|..:.:|.|.|..:.|||.::||.........::.....|||:...:..:||
pombe   379 EDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIAGRPCRLDFSTP 443

  Fly   214 KPENQMMGGMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYY 278
                      |.|  ||.||||||:|||||:              ||.||:|.|           
pombe   444 ----------RTG--GGSRGGRGGFGGRGGF--------------GGRGGFGGG----------- 471

  Fly   279 NGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPRGG 317
                            .|.|.||...||...|...|..|
pombe   472 ----------------RGRGRGGARSGNPNRGSVAPFSG 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 25/76 (33%)
RRM2_hnRNPD_like 137..211 CDD:240775 20/84 (24%)
gar2NP_593531.1 RRM1_gar2 264..339 CDD:240893 25/74 (34%)
RRM2_gar2 368..439 CDD:240894 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1542
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.920

Return to query results.
Submit another query.